Dataset Preview
The full dataset viewer is not available (click to read why). Only showing a preview of the rows.
The dataset generation failed
Error code: DatasetGenerationError
Exception: TypeError
Message: Couldn't cast array of type
struct<RING-type 1; atypical Zinc finger: int64, RING-type 2; degenerate Zinc finger: int64, C4-type Zinc finger: int64, PHD-type Zinc finger: int64, C3H1-type Zinc finger: int64, RING-type Zinc finger: int64, GATA-type Zinc finger: int64, C2H2-type Zinc finger: int64, DBF4-type Zinc finger: int64, CR-type Zinc finger: int64, C2H2-type 3; degenerate Zinc finger: int64, BED-type Zinc finger: int64, CCHC-type Zinc finger: int64, MYND-type Zinc finger: int64, DNL-type Zinc finger: int64, Ig-like V-type Immunoglobulin domain: int64, C2H2-type 1; atypical Zinc finger: int64, C2H2-type 2; atypical Zinc finger: int64, Ig-like C2-type Immunoglobulin domain: int64, C2H2-type 2; degenerate Zinc finger: int64, C2H2-type; degenerate Zinc finger: int64, A20-type Zinc finger: int64, AN1-type Zinc finger: int64, 3CxxC-type Zinc finger: int64, SBP-type Zinc finger: int64, CHHC U11-48K-type Zinc finger: int64, CXXC-type Zinc finger: int64, CW-type Zinc finger: int64, Matrin-type Zinc finger: int64, C6H2-type Zinc finger: int64, RING-type; atypical Zinc finger: int64, SIAH-type; degenerate Zinc finger: int64, NR C4-type Zinc finger: int64, C2H2-type 5; degenerate Zinc finger: int64, C2H2-type 1; degenerate Zinc finger: int64, B box-type Zinc finger: int64, RanBP2-type Zinc finger: int64, SWIM-type Zinc finger: int64, ZZ-type Zinc finger: int64, UBP-type; degenerate Zinc finger: int64, C2HC LYAR-type Zinc finger: int64, CHY-type; degenerate Zinc finger: int64, TRAF-type Zinc finger: int64, FYVE-type Zinc finger: int64, C2H2-type 3; atypical Zinc finger: int64, C2H2-type 4; atypical Zinc finger: int64, C2H2-type 11; atypical Zinc finger: int64, Ig-like Immunoglobulin domain: int64, RIP-type Zinc finger: int64, RING-type 1; degenerate Zinc finger: int64, FYVE-type; degenerate Zinc finger: int64, RING-type; degenerate Zinc finger: int64>
to
{'C2H2-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'Ig-like V-type Immunoglobulin domain': Value(dtype='int64', id=None), 'RING-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'BED-type Zinc finger': Value(dtype='int64', id=None), 'Ig-like C2-type Immunoglobulin domain': Value(dtype='int64', id=None), 'C5HC2 Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 2; degenerate Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 5; degenerate Zinc finger': Value(dtype='int64', id=None), 'CCHC-type Zinc finger': Value(dtype='int64', id=None), 'RING-type Zinc finger': Value(dtype='int64', id=None), 'C4-type Zinc finger': Value(dtype='int64', id=None), 'GATA-type; atypical Zinc finger': Value(dtype='int64', id=None), 'PHD-type; atypical Zinc finger': Value(dtype='int64', id=None), 'SP-RING-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 4; atypical Zinc finger': Value(dtype='int64', id=None), 'C2HC MYST-type Zinc finger': Value(dtype='int64', id=None), 'B box-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'RanBP2-type Zinc finger': Value(dtype='int64', id=None), 'CCHHC-type Zinc finger': Value(dtype='int64', id=None), 'NR C4-type Zinc finger': Value(dtype='int64', id=None), 'UBZ4-type Zinc finger': Value(dtype='int64', id=None), 'Ig-like C1-type Immunoglobulin domain': Value(dtype='int64', id=None), 'TFIIS-type Zinc finger': Value(dtype='int64', id=None), 'FYVE-
...
4', id=None), 'Dof-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 11; degenerate Zinc finger': Value(dtype='int64', id=None), 'UBZ3-type Zinc finger': Value(dtype='int64', id=None), 'PHD-type 2; atypical Zinc finger': Value(dtype='int64', id=None), 'Matrin-type Zinc finger': Value(dtype='int64', id=None), 'MYND-type Zinc finger': Value(dtype='int64', id=None), 'FPG-type Zinc finger': Value(dtype='int64', id=None), 'ZF-HD dimerization-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'NF-X1-type Zinc finger': Value(dtype='int64', id=None), 'SWIM-type Zinc finger': Value(dtype='int64', id=None), 'MYND-type; atypical Zinc finger': Value(dtype='int64', id=None), 'RING-type 1; atypical Zinc finger': Value(dtype='int64', id=None), 'RING-type 2; atypical Zinc finger': Value(dtype='int64', id=None), 'TFIIB-type Zinc finger': Value(dtype='int64', id=None), 'SIAH-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 10; degenerate Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 14; degenerate Zinc finger': Value(dtype='int64', id=None), 'CXXC-type Zinc finger': Value(dtype='int64', id=None), 'NOB1 Zinc finger': Value(dtype='int64', id=None), 'C2H2 AKAP95-type Zinc finger': Value(dtype='int64', id=None), 'MYND-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'A20-type Zinc finger': Value(dtype='int64', id=None), 'AN1-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 11; atypical Zinc finger': Value(dtype='int64', id=None)}
Traceback: Traceback (most recent call last):
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 1870, in _prepare_split_single
writer.write_table(table)
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/arrow_writer.py", line 622, in write_table
pa_table = table_cast(pa_table, self._schema)
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/table.py", line 2292, in table_cast
return cast_table_to_schema(table, schema)
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/table.py", line 2245, in cast_table_to_schema
arrays = [
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/table.py", line 2246, in <listcomp>
cast_array_to_feature(
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/table.py", line 1795, in wrapper
return pa.chunked_array([func(chunk, *args, **kwargs) for chunk in array.chunks])
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/table.py", line 1795, in <listcomp>
return pa.chunked_array([func(chunk, *args, **kwargs) for chunk in array.chunks])
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/table.py", line 2005, in cast_array_to_feature
arrays = [
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/table.py", line 2006, in <listcomp>
_c(array.field(name) if name in array_fields else null_array, subfeature)
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/table.py", line 1797, in wrapper
return func(array, *args, **kwargs)
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/table.py", line 2108, in cast_array_to_feature
raise TypeError(f"Couldn't cast array of type\n{_short_str(array.type)}\nto\n{_short_str(feature)}")
TypeError: Couldn't cast array of type
struct<RING-type 1; atypical Zinc finger: int64, RING-type 2; degenerate Zinc finger: int64, C4-type Zinc finger: int64, PHD-type Zinc finger: int64, C3H1-type Zinc finger: int64, RING-type Zinc finger: int64, GATA-type Zinc finger: int64, C2H2-type Zinc finger: int64, DBF4-type Zinc finger: int64, CR-type Zinc finger: int64, C2H2-type 3; degenerate Zinc finger: int64, BED-type Zinc finger: int64, CCHC-type Zinc finger: int64, MYND-type Zinc finger: int64, DNL-type Zinc finger: int64, Ig-like V-type Immunoglobulin domain: int64, C2H2-type 1; atypical Zinc finger: int64, C2H2-type 2; atypical Zinc finger: int64, Ig-like C2-type Immunoglobulin domain: int64, C2H2-type 2; degenerate Zinc finger: int64, C2H2-type; degenerate Zinc finger: int64, A20-type Zinc finger: int64, AN1-type Zinc finger: int64, 3CxxC-type Zinc finger: int64, SBP-type Zinc finger: int64, CHHC U11-48K-type Zinc finger: int64, CXXC-type Zinc finger: int64, CW-type Zinc finger: int64, Matrin-type Zinc finger: int64, C6H2-type Zinc finger: int64, RING-type; atypical Zinc finger: int64, SIAH-type; degenerate Zinc finger: int64, NR C4-type Zinc finger: int64, C2H2-type 5; degenerate Zinc finger: int64, C2H2-type 1; degenerate Zinc finger: int64, B box-type Zinc finger: int64, RanBP2-type Zinc finger: int64, SWIM-type Zinc finger: int64, ZZ-type Zinc finger: int64, UBP-type; degenerate Zinc finger: int64, C2HC LYAR-type Zinc finger: int64, CHY-type; degenerate Zinc finger: int64, TRAF-type Zinc finger: int64, FYVE-type Zinc finger: int64, C2H2-type 3; atypical Zinc finger: int64, C2H2-type 4; atypical Zinc finger: int64, C2H2-type 11; atypical Zinc finger: int64, Ig-like Immunoglobulin domain: int64, RIP-type Zinc finger: int64, RING-type 1; degenerate Zinc finger: int64, FYVE-type; degenerate Zinc finger: int64, RING-type; degenerate Zinc finger: int64>
to
{'C2H2-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'Ig-like V-type Immunoglobulin domain': Value(dtype='int64', id=None), 'RING-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'BED-type Zinc finger': Value(dtype='int64', id=None), 'Ig-like C2-type Immunoglobulin domain': Value(dtype='int64', id=None), 'C5HC2 Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 2; degenerate Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 5; degenerate Zinc finger': Value(dtype='int64', id=None), 'CCHC-type Zinc finger': Value(dtype='int64', id=None), 'RING-type Zinc finger': Value(dtype='int64', id=None), 'C4-type Zinc finger': Value(dtype='int64', id=None), 'GATA-type; atypical Zinc finger': Value(dtype='int64', id=None), 'PHD-type; atypical Zinc finger': Value(dtype='int64', id=None), 'SP-RING-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 4; atypical Zinc finger': Value(dtype='int64', id=None), 'C2HC MYST-type Zinc finger': Value(dtype='int64', id=None), 'B box-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'RanBP2-type Zinc finger': Value(dtype='int64', id=None), 'CCHHC-type Zinc finger': Value(dtype='int64', id=None), 'NR C4-type Zinc finger': Value(dtype='int64', id=None), 'UBZ4-type Zinc finger': Value(dtype='int64', id=None), 'Ig-like C1-type Immunoglobulin domain': Value(dtype='int64', id=None), 'TFIIS-type Zinc finger': Value(dtype='int64', id=None), 'FYVE-
...
4', id=None), 'Dof-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 11; degenerate Zinc finger': Value(dtype='int64', id=None), 'UBZ3-type Zinc finger': Value(dtype='int64', id=None), 'PHD-type 2; atypical Zinc finger': Value(dtype='int64', id=None), 'Matrin-type Zinc finger': Value(dtype='int64', id=None), 'MYND-type Zinc finger': Value(dtype='int64', id=None), 'FPG-type Zinc finger': Value(dtype='int64', id=None), 'ZF-HD dimerization-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'NF-X1-type Zinc finger': Value(dtype='int64', id=None), 'SWIM-type Zinc finger': Value(dtype='int64', id=None), 'MYND-type; atypical Zinc finger': Value(dtype='int64', id=None), 'RING-type 1; atypical Zinc finger': Value(dtype='int64', id=None), 'RING-type 2; atypical Zinc finger': Value(dtype='int64', id=None), 'TFIIB-type Zinc finger': Value(dtype='int64', id=None), 'SIAH-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 10; degenerate Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 14; degenerate Zinc finger': Value(dtype='int64', id=None), 'CXXC-type Zinc finger': Value(dtype='int64', id=None), 'NOB1 Zinc finger': Value(dtype='int64', id=None), 'C2H2 AKAP95-type Zinc finger': Value(dtype='int64', id=None), 'MYND-type; degenerate Zinc finger': Value(dtype='int64', id=None), 'A20-type Zinc finger': Value(dtype='int64', id=None), 'AN1-type Zinc finger': Value(dtype='int64', id=None), 'C2H2-type 11; atypical Zinc finger': Value(dtype='int64', id=None)}
The above exception was the direct cause of the following exception:
Traceback (most recent call last):
File "/src/services/worker/src/worker/job_runners/config/parquet_and_info.py", line 1417, in compute_config_parquet_and_info_response
parquet_operations = convert_to_parquet(builder)
File "/src/services/worker/src/worker/job_runners/config/parquet_and_info.py", line 1049, in convert_to_parquet
builder.download_and_prepare(
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 924, in download_and_prepare
self._download_and_prepare(
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 1000, in _download_and_prepare
self._prepare_split(split_generator, **prepare_split_kwargs)
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 1741, in _prepare_split
for job_id, done, content in self._prepare_split_single(
File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 1897, in _prepare_split_single
raise DatasetGenerationError("An error occurred while generating the dataset") from e
datasets.exceptions.DatasetGenerationError: An error occurred while generating the datasetNeed help to make the dataset viewer work? Make sure to review how to configure the dataset viewer, and open a discussion for direct support.
primaryAccession string | text string | functionDomainRange list | meta_data dict | sequence dict |
|---|---|---|---|---|
A0A4Z3 | This is Alpha-1,3-galactosyltransferase 2 protein, from Rat, contains 339 amino acids, is membrane-bound, locates in Golgi apparatus. | [] | {
"primaryAccession": "A0A4Z3",
"organism_name": "Rat",
"protein_name": "Alpha-1,3-galactosyltransferase 2",
"length": 339,
"firstPublicDate": "2008-01-15T00:00:00",
"FUNCTION": "Synthesizes the galactose-alpha(1,3)-galactose group on the glycosphingolipid isoglobotrihexosylceramide or isogloboside 3 (iGb3)... | {
"value": "MALEGLRAKKRLLWRLFLSAFGLLGLYHYWFKIFRLFEVFIPMGICPMAIMPLLKDNFTGVLRHWARPEVLTCTSWGAPIIWDETFDPHVAEREARRQNLTIGLTVFAVGRYLEKYLEHFLVSAEQYFMVGQNVVYYVFTDRPEAVPHVALGQGRLLRVKPVRREKRWQDVSMARMLTLHEALGGQLGREADYVFCLDVDQYFSGNFGPEVLADLVAQLHAWHFRWPRWMLPYERDKRSAAALSLSEGDFYYHAAVFGGSVAALLKLTAHCATGQQLDREHGIEARWHDESHLNKFFWLSKPTKLL... |
A0A8M2 | This is Protein LSM14 homolog A-A protein, from African clawed frog, contains 471 amino acids, is soluble, locates in Cytoplasm. | [] | {
"primaryAccession": "A0A8M2",
"organism_name": "African clawed frog",
"protein_name": "Protein LSM14 homolog A-A",
"length": 471,
"firstPublicDate": "2010-02-09T00:00:00",
"FUNCTION": "RNA-binding component of messenger ribonucleoprotein complexes (mRNPs), storage particles that mask maternal mRNAs from t... | {
"value": "MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEIFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSLGSSSASSFQSVSSYGPFGRMPAYSQFNTGPLVGPQFGAVGVGSSLTSFGAETTSSTSLPPSSAVGTSFTQEARTLKTQSSQGQSSSPLDSLRKSPNIEQAVQTAAAPHAPSTATVGRRSPVLSRPVPSSIQKTAESPEQRKGELHKMQRPDIDQLKNDKNDPSKRQPVLSALQPRRGRGGNRGGRGRFGVRRDGPMKFEKDFDFESAN... |
A0JNT9 | This is BICD family-like cargo adapter 1 protein, from Mouse, contains 577 amino acids, is soluble, locates in Cytoplasm. | [] | {
"primaryAccession": "A0JNT9",
"organism_name": "Mouse",
"protein_name": "BICD family-like cargo adapter 1",
"length": 577,
"firstPublicDate": "2007-09-11T00:00:00",
"FUNCTION": "Acts as an adapter protein linking the dynein motor complex to various cargos and converts dynein from a non-processive to a hig... | {
"value": "MSAFCLGLAGRASAPAEPDSACCMELPAGAGDAVRSPATAAALVSFPGGPGELELALEEELALLAAGERSSEPGEHPQAEPESPVEGHGPPLPPPPTQDPELLSVIRQKEKDLVLAARLGKALLERNQDMSRQYEQMHKELTDKLEHLEQEKHELRRRFENREGEWEGRVSELETDVKQLQDELERQQLHLREADREKTRAVQELSEQNQRLLDQLSRASEVERQLSMQVHALKEDFREKNSSTNQHIIRLESLQAEIKMLSDRKRELEHRLSATLEENDLLQGTVEELQDRVLILERQGHDKDLQ... |
A0JPL0 | This is Zinc finger protein 382 protein, from Rat, contains 549 amino acids, has 10 C2H2-type Zinc finger, locates in Nucleus. | [
{
"location": [
211,
233
],
"description": "C2H2-type",
"keyword_description": "Zinc finger",
"textural_description": "C2H2-type Zinc finger"
},
{
"location": [
295,
317
],
"description": "C2H2-type",
"keyword_description": "Zinc finger",
"textural... | {
"primaryAccession": "A0JPL0",
"organism_name": "Rat",
"protein_name": "Zinc finger protein 382",
"length": 549,
"firstPublicDate": "2009-01-20T00:00:00",
"FUNCTION": "Functions as a sequence-specific transcriptional repressor",
"SUBCELLULAR LOCATION": "Nucleus",
"SIMILARITY": "Belongs to the krueppel ... | {
"value": "MNCHSVPLQGPVSFKDVTVDFTQEEWQRLDPAQKALYRDVMLENYCHFISVGFHITKPDMIRKLEQGEELWTERMFPSQSYLEDEEVLVKFRDYQDKPPTSIVIINHKKLIKERNNVYEKTLGNNHIISKTLFEYKSDGKVLKNISDFISRDINPVMGTLGDSSEWEESVLTSEQEKTHPVPTLYKQIGRNLSSSLELAQHQKTQIPEQRFECDECDSSFLMTEVAFPHDRAHRGVRDFNCSKDEIAFFEKSDLGIHPHNLMEKKCSTYNKYGKLLCRKSVFVMHPRSQVDERPFQCPYCGNSFRR... |
A0PJK1 | This is Sodium/mannose cotransporter SLC5A10 protein, from Human, contains 596 amino acids, is membrane-bound, locates in Cell membrane. | [] | {
"primaryAccession": "A0PJK1",
"organism_name": "Human",
"protein_name": "Sodium/mannose cotransporter SLC5A10",
"length": 596,
"firstPublicDate": "2007-11-13T00:00:00",
"FUNCTION": "Appears to have no transporter activity",
"SUBCELLULAR LOCATION": "Cell membrane",
"SIMILARITY": "Belongs to the sodium:... | {
"value": "MAANSTSDLHTPGTQLSVADIIVITVYFALNVAVGIWSSCRASRNTVNGYFLAGRDMTWWPIGASLFASSEGSGLFIGLAGSGAAGGLAVAGFEWNATYVLLALAWVFVPIYISSEIVTLPEYIQKRYGGQRIRMYLSVLSLLLSVFTKISLDLYAGALFVHICLGWNFYLSTILTLGITALYTIAGGLAAVIYTDALQTLIMVVGAVILTIKAFDQIGGYGQLEAAYAQAIPSRTIANTTCHLPRTDAMHMFRDPHTGDLPWTGMTFGLTIMATWYWCTDQVIVQRSLSARDLNHAKAGSILASY... |
A0S864 | This is Irditoxin subunit A protein, from Brown tree snake, contains 109 amino acids, is soluble, locates in Extracellular. | [] | {
"primaryAccession": "A0S864",
"organism_name": "Brown tree snake",
"protein_name": "Irditoxin subunit A",
"length": 109,
"firstPublicDate": "2008-01-15T00:00:00",
"FUNCTION": "This bird and reptile-specific postsynaptic neurotoxin inhibits the chick muscle alpha-1-beta-1-gamma-delta (CHRNA1-CHRNB1-CHRNG-C... | {
"value": "MKTLLLAVAVVAFVCLGSADQLGLGRQQIDWGQGQAVGPPYTLCFECNRMTSSDCSTALRCYRGSCYTLYRPDENCELKWAVKGCAETCPTAGPNERVKCCRSPRCNDD",
"length": 109,
"molWeight": 11938,
"crc64": "D2E1E5D42E467A12",
"md5": "5541F38B86EE1061705EFFCD6632C698"
} |
A0S865 | This is Irditoxin subunit B protein, from Brown tree snake, contains 111 amino acids, is soluble, locates in Extracellular. | [] | {
"primaryAccession": "A0S865",
"organism_name": "Brown tree snake",
"protein_name": "Irditoxin subunit B",
"length": 111,
"firstPublicDate": "2008-01-15T00:00:00",
"FUNCTION": "This bird and reptile-specific postsynaptic neurotoxin inhibits the chick muscle alpha-1-beta-1-gamma-delta (CHRNA1-CHRNB1-CHRNG-C... | {
"value": "MKTLLLAVAVVAFVCLGSADQLGLGRQQIDWGKGQAKGPPYTLCFECNRETCSNCFKDNRCPPYHRTCYTLYRPDGNGEMKWAVKGCAKTCPTAQPGESVQCCNTPKCNDY",
"length": 111,
"molWeight": 12236,
"crc64": "448F0CEE68E92E12",
"md5": "C74EFA125A9245AFC5881535EEA49577"
} |
A1A519 | This is Protein FAM170A protein, from Human, contains 330 amino acids, has 1 C2H2-type; degenerate Zinc finger, locates in Nucleus. | [
{
"location": [
228,
252
],
"description": "C2H2-type; degenerate",
"keyword_description": "Zinc finger",
"textural_description": "C2H2-type; degenerate Zinc finger"
}
] | {
"primaryAccession": "A1A519",
"organism_name": "Human",
"protein_name": "Protein FAM170A",
"length": 330,
"firstPublicDate": "2008-03-18T00:00:00",
"FUNCTION": "Acts as a nuclear transcription factor that positively regulates the expression of heat shock genes, Binds to heat shock promoter elements (HSE)"... | {
"value": "MKRRQKRKHLENEESQETAEKGGGMSKSQEDALQPGSTRVAKGWSQGVGEVTSTSEYCSCVSSSRKLIHSGIQRIHRDSPQPQSPLAQVQERGETPPRSQHVSLSSYSSYKTCVSSLCVNKEERGMKIYYMQVQMNKGVAVSWETEETLESLEKQPRMEEVTLSEVVRVGTPPSDVSTRNLLSDSEPSGEEKEHEERTESDSLPGSPTVEDTPRAKTPDWLVTMENGFRCMACCRVFTTMEALQEHVQFGIREGFSCHVFHLTMAQLTGNMESESTQDEQEEENGNEKEEEEKPEAKEEEGQPTEE... |
A1A5B4 | This is Anoctamin-9 protein, from Human, contains 782 amino acids, is membrane-bound, locates in Cell membrane. | [] | {
"primaryAccession": "A1A5B4",
"organism_name": "Human",
"protein_name": "Anoctamin-9",
"length": 782,
"firstPublicDate": "2007-05-29T00:00:00",
"FUNCTION": "Has calcium-dependent phospholipid scramblase activity; scrambles phosphatidylserine, phosphatidylcholine and galactosylceramide (By similarity), Doe... | {
"value": "MQGEESLRILVEPEGDSFPLMEISTCETEASEQWDYVLVAQRHTQRDPRQARQQQFLEELRRKGFHIKVIRDQKQVFFGIRADNSVFGLYRTLLLEPEGPAPHAELAAPTTIPVTTSLRIRIVNFVVMNNKTSAGETFEDLMKDGVFEARFPLHKGEGRLKKTWARWRHMFREQPVDEIRNYFGEKVALYFVWLGWYTYMLVPAALTGLLVFLSGFSLFEASQISKEICEAHDILMCPLGDHSRRYQRLSETCTFAKLTHLFDNDGTVVFAIFMALWATVFLEIWKRQRARVVLHWDLYVWDEEQE... |
A1L167 | This is Ubiquitin-conjugating enzyme E2Q-like protein 1 protein, from Human, contains 161 amino acids, locates in Nucleus. | [] | {
"primaryAccession": "A1L167",
"organism_name": "Human",
"protein_name": "Ubiquitin-conjugating enzyme E2Q-like protein 1",
"length": 161,
"firstPublicDate": "2008-05-20T00:00:00",
"FUNCTION": "Probable E2 ubiquitin-protein ligase that catalyzes the covalent attachment of ubiquitin to target proteins, May ... | {
"value": "MKELQDIARLSDRFISVELVDESLFDWNVKLHQVDKDSVLWQDMKETNTEFILLNLTFPDNFPFSPPFMRVLSPRLENGYVLDGGAICMELLTPRGWSSAYTVEAVMRQFAASLVKGQGRICRKAGKSKKSFSRKEAEATFKSLVKTHEKYGWVTPPVSDG",
"length": 161,
"molWeight": 18338,
"crc64": "B2062702B5EFB2A2",
"md5": "1C92D5FD1F67D62E8F9F1BA47135EE90"
} |
A1L3G9 | This is Nuclear envelope integral membrane protein 1b protein, from African clawed frog, contains 434 amino acids, is membrane-bound, locates in Nucleus. | [] | {
"primaryAccession": "A1L3G9",
"organism_name": "African clawed frog",
"protein_name": "Nuclear envelope integral membrane protein 1b",
"length": 434,
"firstPublicDate": "2008-04-29T00:00:00",
"FUNCTION": "In concert with ran, required for proper eye development (PubMed:25946333), May be involved in the ex... | {
"value": "MAGEVEGRGCGFSLGVLVTLLVLPLPSLCTLSTEKELHVIKLYEGRMVRYNESRNFCYQRTYEPKWSDVWTKIQIRINSTKMIRVTQVDNEEKLKEMETFNMFDFFSSFLKEKLNDTFIYVNLYSNKTCVKVHLTDTDTYYSVALSRGFDPRLFFVFLCGLLLFFYGDTLSRSQLFFYSTGITVGMLASMLILVFMLSKLMPKKSPFFALLLGGWSVSIYVIQLVFRNLQAICSEYWQYLIVYLGIVGFVSFAFCYIYGPLENERSINILNWTLQLIGLLLMYVSVQIQHIAVTIVVIAFCTKQIE... |
A1L3X0 | This is Elongation of very long chain fatty acids protein 7 protein, from Human, contains 281 amino acids, is membrane-bound, locates in Endoplasmic reticulum. | [] | {
"primaryAccession": "A1L3X0",
"organism_name": "Human",
"protein_name": "Elongation of very long chain fatty acids protein 7",
"length": 281,
"firstPublicDate": "2007-12-04T00:00:00",
"FUNCTION": "Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty aci... | {
"value": "MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKYLWWKKYLTSLQLVQFVIVAIHISQFFFMEDCKYQFPVFACIIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKNKDN",
"length": 281,
"mo... |
A1Y9I9 | This is Transmembrane O-methyltransferase homolog protein, from Mouse, contains 258 amino acids, is soluble, locates in Cytoplasm. | [] | {
"primaryAccession": "A1Y9I9",
"organism_name": "Mouse",
"protein_name": "Transmembrane O-methyltransferase homolog",
"length": 258,
"firstPublicDate": "2008-12-16T00:00:00",
"FUNCTION": "Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones (Pu... | {
"value": "MSPAIALAFLPLVVTLLVRYRHHFRLLVRTVLLRGFRDCLSGLRIEERAFSYVLTHALPGDPGHILTTLDHWSSCCEYLSHMGPVKGQILMRLVEEKAPACVLELGTYCGYSTLLIARALPPGSRLLTVERDSRTAAVAEKVIRLAGFDEQMVELIAGSSEEVIPRLRAQHQLNRADLVLLAHRPRYYLRDLQLLEAHALLPHGATVLADHVLFPGAPRFLQYTKSCGRYRCRLHHTSLPDFPAIKDGIAQLTYTGPG",
"length": 258,
"molWeight": 28846,
"crc... |
A1YKT1 | This is Transcription factor TCP18 protein, from Mouse-ear cress, contains 433 amino acids, locates in Nucleus. | [] | {
"primaryAccession": "A1YKT1",
"organism_name": "Mouse-ear cress",
"protein_name": "Transcription factor TCP18",
"length": 433,
"firstPublicDate": "2008-04-29T00:00:00",
"FUNCTION": "Transcription factor that prevents axillary bud outgrowth and delays early axillary bud development, Indirectly required for... | {
"value": "MNNNIFSTTTTINDDYMLFPYNDHYSSQPLLPFSPSSSINDILIHSTSNTSNNHLDHHHQFQQPSPFSHFEFAPDCALLTSFHPENNGHDDNQTIPNDNHHPSLHFPLNNTIVEQPTEPSETINLIEDSQRISTSQDPKMKKAKKPSRTDRHSKIKTAKGTRDRRMRLSLDVAKELFGLQDMLGFDKASKTVEWLLTQAKPEIIKIATTLSHHGCFSSGDESHIRPVLGSMDTSSDLCELASMWTVDDRGSNTNTTETRGNKVDGRSMRGKRKRPEPRTPILKKLSKEERAKARERAKGRTMEKMM... |
A1Z8N1 | This is Facilitated trehalose transporter Tret1-1 protein, from Fruit fly, contains 857 amino acids, is membrane-bound, locates in Cell membrane. | [] | {
"primaryAccession": "A1Z8N1",
"organism_name": "Fruit fly",
"protein_name": "Facilitated trehalose transporter Tret1-1",
"length": 857,
"firstPublicDate": "2010-07-13T00:00:00",
"FUNCTION": "Low-capacity facilitative transporter for trehalose, Does not transport maltose, sucrose or lactose, Mediates the b... | {
"value": "MSGRDNRGAGGGGGGHQPLSNAMGKLKEKLTRVGDELGYHRVESNLSTSNTATSLDTILPEDPFLFPQVSPQRHPQNTVRTQRLLEDEPPLSFRPLLEDDDINEPPTQQQQRTPLRASGSLELTPLPPPPTSLEIREHRDRQQRGAQGDELQRSKQSLKGSRVSFERRDTGNSNTNSNKAAESSDEDSFEEKRTGFQQQKATSVDHKGILKDLKHILANDNRRQFQAKKHVSLDVKGTRFLQDLLKESSSEEEFHKTRREFQGRKHQSLDPRVTFKLDKVLQGSSTDSDEEGEDAEHKRLIHRPKD... |
A2AG06 | This is Meiosis-specific coiled-coil domain-containing protein MEIOC protein, from Mouse, contains 965 amino acids, is soluble, locates in Cytoplasm. | [] | {
"primaryAccession": "A2AG06",
"organism_name": "Mouse",
"protein_name": "Meiosis-specific coiled-coil domain-containing protein MEIOC",
"length": 965,
"firstPublicDate": "2010-04-20T00:00:00",
"FUNCTION": "Is required for meiosis completion in both male and female germ cells, Confers stability to numerous... | {
"value": "MEVSGGDTCRPRHPQGLREGPEPKVAAAAAAFRGSANRCWNLSVDTSNRLSDVFNSMMLTGSAPFYDCYKSQNEDNVDLRQTCTPLSSSTEYASSIDSSLFYAPWSTYGDDIKQPPSSQISVKNRIQTERNDYGSETDLYGLVSNILEEQDKSQPYFAEGTCSSNLKSVWPMNTSRFVDHHDLLTEPKRPVDTSISQQAFYSGESVSAVEKQYLHNSSLTPQQKIDELYHGYTGLDLEEQWLYLSRSDHSNCYNSQANDTVKATFQEYPFVKNCFTPQTGLSDIMKESGIDTYAYGREKICTKGLE... |
A2AJB7 | This is Epididymal-specific lipocalin-5 protein, from Mouse, contains 192 amino acids, is soluble, locates in Extracellular. | [] | {
"primaryAccession": "A2AJB7",
"organism_name": "Mouse",
"protein_name": "Epididymal-specific lipocalin-5",
"length": 192,
"firstPublicDate": "2008-06-10T00:00:00",
"FUNCTION": "Associates with spermatozoa in the epididymal fluid but does not bind tightly to them, Binds both all-trans and 13-cis retinoic a... | {
"value": "MCSVARHMESIMLFTLLGLCVGLAAGTEAAVVKDFDVNKFLGFWYEIALASKMGAYGLAHKEEKMGAMVVELKENLLALTTTYYNEGHCVLEKVAATQVDGSAKYKVTRISGEKEVVVVATDYMTYTVIDITSLVAGAVHRAMKLYSRSLDNNGEALNNFQKIALKHGFSETDIHILKHDLTCVNALQSGQI",
"length": 192,
"molWeight": 21013,
"crc64": "E91DA019DEF21F5B",
"md5": "798EFB2F32EF28243A2C43AB5C4EE46... |
A2AKK5 | This is Acyl-coenzyme A amino acid N-acyltransferase 1 protein, from Mouse, contains 416 amino acids, locates in Peroxisome. | [] | {
"primaryAccession": "A2AKK5",
"organism_name": "Mouse",
"protein_name": "Acyl-coenzyme A amino acid N-acyltransferase 1",
"length": 416,
"firstPublicDate": "2008-10-14T00:00:00",
"FUNCTION": "Acyltransferase which efficiently conjugates very long-chain and long-chain fatty acids to taurine (PubMed:1711673... | {
"value": "MMIKLIATPSNALVDEPVSIRATGLPPSQIVTIKATVKDENDNVFQSQAFYKTNEAGEVDLEKTPALGGDYVGVHPMGLFFSLKPKKAFHRLMKKDVMNSPFCICLDLYDSVNWLETVRIPSKASQRVQRWFVGPGVKREQIQEGRVRGALFLPPGKGPFPGIIDLFGVIGGLVEFRASLLASHGFAVLALAYFAYKDLPEKLQEVDLEYFEEAANFLLSHPKIQQPGIGVISTSKGAEIGLAMACYLKQVIATVCINGATTTTAVPLRYQDLVVTPIQQALERMEVHVSGAVCFRHTTQYLQNKN... |
A2AM29 | This is Protein AF-9 protein, from Mouse, contains 569 amino acids, locates in Nucleus. | [] | {
"primaryAccession": "A2AM29",
"organism_name": "Mouse",
"protein_name": "Protein AF-9",
"length": 569,
"firstPublicDate": "2007-10-02T00:00:00",
"FUNCTION": "Chromatin reader component of the super elongation complex (SEC), a complex required to increase the catalytic rate of RNA polymerase II transcripti... | {
"value": "MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPKKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGGDPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKDSREHKSAFKEPSRDHNKSSKDSSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKADSNLLTVTSGQQDKKAPSKRPPASDSEELSAKKRKKSSSEA... |
A2ARI4 | This is Leucine-rich repeat-containing G-protein coupled receptor 4 protein, from Mouse, contains 951 amino acids, is membrane-bound, locates in Cell membrane. | [] | {
"primaryAccession": "A2ARI4",
"organism_name": "Mouse",
"protein_name": "Leucine-rich repeat-containing G-protein coupled receptor 4",
"length": 951,
"firstPublicDate": "2007-09-11T00:00:00",
"FUNCTION": "Receptor for R-spondins that potentiates the canonical Wnt signaling pathway and is involved in the f... | {
"value": "MPGPLRLLCFFALGLLGSAGPSGAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNILTEVPVRPLSNLPTLQALTLALNNISSIPDFAFTNLSSLVVLHLHNNKIKSLSQHCFDGLDNLETLDLNYNNLDEFPQAIKALPSLKELGFHSNSISVIPDGAFAGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGA... |
A2AU37 | This is Double-strand-break repair protein rad21-like protein 1 protein, from Mouse, contains 552 amino acids, locates in Nucleus. | [] | {
"primaryAccession": "A2AU37",
"organism_name": "Mouse",
"protein_name": "Double-strand-break repair protein rad21-like protein 1",
"length": 552,
"firstPublicDate": "2008-02-26T00:00:00",
"FUNCTION": "Meiosis-specific component of some cohesin complex required during the initial steps of prophase I in mal... | {
"value": "MFYTHVLMSKRGPLAKIWLAAHWEKKLTKAHVFECNLEITIQKIISPKVKIALRTSGHLLLGVVRIYNRKAKYLLADCSEAFLKMKMTFRPGLVDLPKENFEAAYNTITLPEEFHDFEIYNINEIDISEPLAQNQSRPEEITLREEYSNDLLFQAGSFGDEPEILRRHSFFDDNILMNSSGLVVEHSSGSFAEEKSLFFDNGDGFGDEGAAGEMIDNLLQDESTFLEEAYLNKEVSLPPELPSSIMVEPGNSDDQCIPEDEEINEITLLSNEDEGFTLDPIDDLDIADRRRRKKRRLLVDPVKEIS... |
A2RVM0 | This is Short-chain dehydrogenase TIC 32, chloroplastic protein, from Mouse-ear cress, contains 322 amino acids, is membrane-bound, locates in Plastid. | [] | {
"primaryAccession": "A2RVM0",
"organism_name": "Mouse-ear cress",
"protein_name": "Short-chain dehydrogenase TIC 32, chloroplastic",
"length": 322,
"firstPublicDate": "2011-10-19T00:00:00",
"FUNCTION": "Involved in protein precursor import into chloroplasts, Part of the redox regulon consisting of TIC32, ... | {
"value": "MWFFGSKGASGFSSRSTAEEVTHGVDGTGLTAIVTGASSGIGVETARVLSLRGVHVVMAVRNTDSGAKVKEDIVKQVPGAKLDVMELDLSSMQSVRKFASEYKSTGLPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKSTSRESKREGRIVNLSSEAHRFSYPEGVRFDKINDKSSYSSMRAYGQSKLCNVLHANELTKQLKEDGVNITANSLHPGAIMTNLGRYFNPYLAVAVGAVAKYILKSVPQGAATTCYVALNPQVAGVSGEYFQDSNIAKPLPLVKDTELAKKVW... |
A2VBC4 | This is Phospholipase A1 protein, from Neotropical social wasp, contains 322 amino acids, is soluble, locates in Extracellular. | [] | {
"primaryAccession": "A2VBC4",
"organism_name": "Neotropical social wasp",
"protein_name": "Phospholipase A1",
"length": 322,
"firstPublicDate": "2008-01-15T00:00:00",
"FUNCTION": "Catalyzes the hydrolysis of phosphatidylcholine with phospholipase A1 activity (PubMed:17761205), Shows hemolytic activity (Pu... | {
"value": "MNFKYSILFICFGTLDRGLIPECPFNEYDILFFVYTRQQRDGIVLTEETLQNYDLFKKSTISRQVVFIDHGFLSNGNNENFIAMAKALIEKDNFLVISVDWKKGACNAFASTLDYLGYSTAVGNTRHVGKYVADFTKLLVEQYKVSMSNIRLIGHSLGAHTSGFAGKEVQELKLNKYSNIDGLDPAGPSFDSNDCPERLCETDAEYVQIIHTSNILGVYSKIGTVDFYMNYGSHQPGCGRFFSPSCSHTKAVKYLTECIKHECCLIGTPWKKYFSTPKPISQCTKDTCVCVGLNAKSYPARGSFYV... |
A2VCW5 | This is Sodium-coupled neutral amino acid transporter 5 protein, from Rat, contains 479 amino acids, is membrane-bound, locates in Cell membrane. | [] | {
"primaryAccession": "A2VCW5",
"organism_name": "Rat",
"protein_name": "Sodium-coupled neutral amino acid transporter 5",
"length": 479,
"firstPublicDate": "2007-12-04T00:00:00",
"FUNCTION": "Symporter that cotransports neutral amino acids and sodium ions, coupled to an H(+) antiporter activity (PubMed:116... | {
"value": "MAISCAVGMEMQEPKMNGTLSTGAAAGYRQEREGFLPTTHGPAPGRKPVQFLDFEGKTSFGMSVFNLSNAIMGSGILGLAYAMAHTGVIFFLALLLCIALLSSYSIHLLLTCASVVGIRAYEQLGQRAFGPAGKVVVAIIICLHNVGAMSSYLFIIKSELPLVIGTFLHMDPEGDWFLKGNLLIILVSLLIILPLALMKHLGYLGYTSSLSLTCMLFFLISVIYKKFQLGCVVSHNDTVVESEPAPLQAFNSSCEAKLFTVDSQMSYTVPIMAFAFVCHPEVLPIYTELCCPTQRRMQAVANMSIG... |
A4D1E9 | This is GTP-binding protein 10 protein, from Human, contains 387 amino acids, locates in Nucleus. | [] | {
"primaryAccession": "A4D1E9",
"organism_name": "Human",
"protein_name": "GTP-binding protein 10",
"length": 387,
"firstPublicDate": "2007-12-04T00:00:00",
"FUNCTION": "May be involved in the ribosome maturation process, Complements an ObgE(CgtA) function in E,coli ribosome maturation, Plays a role of GTPa... | {
"value": "MVHCSCVLFRKYGNFIDKLRLFTRGGSGGMGYPRLGGEGGKGGDVWVVAQNRMTLKQLKDRYPRKRFVAGVGANSKISALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYSDFKQISVADLPGLIEGAHMNKGMGHKFLKHIERTRQLLFVVDISGFQLSSHTQYRTAFETIILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFLHLF... |
A4L691 | This is PIN2/TERF1-interacting telomerase inhibitor 1 protein, from Rat, contains 331 amino acids, locates in Nucleus. | [] | {
"primaryAccession": "A4L691",
"organism_name": "Rat",
"protein_name": "PIN2/TERF1-interacting telomerase inhibitor 1",
"length": 331,
"firstPublicDate": "2007-07-10T00:00:00",
"FUNCTION": "Microtubule-binding protein essential for faithful chromosome segregation, Mediates TRF1 and TERT accumulation in nuc... | {
"value": "MSMLAERRRKQKWAVDPRNTAWSNDDSKFGQKMLEKMGWSKGKGLGAQEQGATEHIKVKVKNNHLGLGATNNNEDNWIAHQDDFNQLLAALNTCHGQETADSSDNKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSETDLDCIFGKRRNKKLAQDGCSNSTADEADTSLTTTTTTTSAFTIQEYFAKRMAQLKSKSQAAAPGSDLSETPIEWKKGKKKTKEAAGTDIENSPQHKAKRHKKKKRVEAERGPAAKKRDQVELQPGGPSGDECSDASVEAAEDRVQTPDTQDDVPKPRKRRAKKTL... |
A4PES0 | This is Wee1-like protein kinase 2 protein, from Pig, contains 565 amino acids, locates in Nucleus. | [] | {
"primaryAccession": "A4PES0",
"organism_name": "Pig",
"protein_name": "Wee1-like protein kinase 2",
"length": 565,
"firstPublicDate": "2011-05-31T00:00:00",
"FUNCTION": "Oocyte-specific protein tyrosine kinase that phosphorylates and inhibits CDK1 and acts as a key regulator of meiosis during both prophas... | {
"value": "MGDNGDNKELKQKLNFSYSEEEQEDEGQKEAQESKKVQYHTPERCGHQDSEAKFTPPRTPLNHVCELSTPQVKDRASPDQGLRTPVSRPHTRPETPAPPDKSKPPPHCESPFTPRGHSSQSVISTGKLPSRGSKHLRLTPGPLTDEMTSLALVNINPFTPESYRRQFLKSNGKRKTRRDLEEAGPEEGKVEKGLPAKRCVLRETNMACRYEKEFLEVEKIGVGEFGTVYKCIKRLDGCVYAIKRSTKPVSGLSDENLAMHEVYAHSVLGHHPHVVRYYSSWAEDDHMMIQNEYCNGGSLQAAISEN... |
A4QUT2 | This is Catalase-peroxidase 2 protein, from Rice blast fungus, contains 786 amino acids, is soluble, locates in Extracellular. | [] | {
"primaryAccession": "A4QUT2",
"organism_name": "Rice blast fungus",
"protein_name": "Catalase-peroxidase 2",
"length": 786,
"firstPublicDate": "2008-07-22T00:00:00",
"FUNCTION": "Bifunctional enzyme with both catalase and broad-spectrum peroxidase activity, Confers resistance to H(2)O(2) in hyphae, May pl... | {
"value": "MHASLSSWLLAASLLTQPISVSGQGCPFAKRDGTVDSSLPQKRADAPETTTFGRCAVKSNQAGGGTRSHDWWPCQLRLDVLRQFQPSQNPLGGDFDYAEAFQSLDYEAVKKDIAALMTESQDWWPADFGNYGGLFVRMAWHSAGTYRAMDGRGGGGMGQQRFAPLNSWPDNQNLDKARRLIWPIKQKYGNKISWADLMLLTGNVALENMGFKTLGFGGGRADTWQSDEAVYWGAETTFVPQGNDVRYNNSVDINARADKLEKPLAATHMGLIYVNPEGPNGTPDPAASAKDIREAFGRMGMNDTET... |
A4VCL2 | This is Extracellular serine/threonine protein CG31145 protein, from Fruit fly, contains 528 amino acids, is membrane-bound, locates in Golgi apparatus. | [] | {
"primaryAccession": "A4VCL2",
"organism_name": "Fruit fly",
"protein_name": "Extracellular serine/threonine protein CG31145",
"length": 528,
"firstPublicDate": "2015-07-22T00:00:00",
"FUNCTION": "Golgi serine/threonine protein kinase that phosphorylates secretory pathway proteins within Ser-x-Glu/pSer mot... | {
"value": "MAVLRTMKLKERLVISLGATLVLLTLLLIVDVQMDFGVANRHLLQQQHQKIRLGNDYDGGTGGGGMLHEFKRKFLQKSNASGSKEASTQAGASQSGGATSGQDAAAGASGGAAGPGTSRSTSTRKPTPHDRYADLQKHLLSDEYSHVIVDNAPDVSRDNPTLAEMLHRKASANASNLERFQLRITKKELYGEQDTLVDAVLRDMIKLPIQHVVQKEGGTQLKLIIEYPNDIKALMKPMRFPREQQTLPNHFYFTDYERHNAEIAAFHLDRILGFRRAMPVAGRTLNITTEIYQLAEENLLKTFFVS... |
A5JUY8 | This is Lactoperoxidase protein, from Domestic water buffalo, contains 712 amino acids, is soluble, locates in Extracellular. | [] | {
"primaryAccession": "A5JUY8",
"organism_name": "Domestic water buffalo",
"protein_name": "Lactoperoxidase",
"length": 712,
"firstPublicDate": "2014-01-22T00:00:00",
"FUNCTION": "Heme-containing oxidoreductase which catalyzes the conversion of thiocyanate (SCN(-)) into antimicrobial agent hypothiocyanous a... | {
"value": "MWVCLQLPVFLASVTLFEVAASDTIAQAASTTTISDAVSKVKIQVNKAFLDSRTRLKTTLSSEAPTTQQLSEYFKHAKGQTRTAIRNGQVWEESFKRLRRDTTLTNVTDPSLDLTALSWEVGCGAPVPLVKCDENSPYRTITGDCNNRRSPALGAANRALARWLPAEYEDGLALPFGWTQRKTRNGFRVPLAREVSNKIVGYLDEEGVLDQNRSLLFMQWGQIVDHDLDFAPETELGSNEHSKTQCEEYCIQGDNCFPIMFPKNDPKLKTQGKCMPFFRAGFVCPTPPYQSLAREQINAVTSFLDA... |
A5PLL7 | This is Plasmanylethanolamine desaturase 1 protein, from Human, contains 270 amino acids, is membrane-bound, locates in Endoplasmic reticulum. | [] | {
"primaryAccession": "A5PLL7",
"organism_name": "Human",
"protein_name": "Plasmanylethanolamine desaturase 1",
"length": 270,
"firstPublicDate": "2008-02-26T00:00:00",
"FUNCTION": "Plasmanylethanolamine desaturase involved in plasmalogen biogenesis in the endoplasmic reticulum membrane (PubMed:31604315, Pu... | {
"value": "MAGAENWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARWEDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK",
"length": 270,
"molWeight": 3... |
A5X5Y0 | This is 5-hydroxytryptamine receptor 3E protein, from Human, contains 456 amino acids, is membrane-bound, locates in Cell membrane. | [] | {
"primaryAccession": "A5X5Y0",
"organism_name": "Human",
"protein_name": "5-hydroxytryptamine receptor 3E",
"length": 456,
"firstPublicDate": "2007-12-04T00:00:00",
"FUNCTION": "This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurot... | {
"value": "MEGSWFHRKRFSFYLLLGFLLQGRGVTFTINCSGFGQHGADPTALNSVFNRKPFRPVTNISVPTQVNISFAMSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRGGNLYDQIVFYVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLLPTSGTP... |
A6H687 | This is SAC3 domain-containing protein 1 protein, from Mouse, contains 427 amino acids, is soluble, locates in Cytoplasm. | [] | {
"primaryAccession": "A6H687",
"organism_name": "Mouse",
"protein_name": "SAC3 domain-containing protein 1",
"length": 427,
"firstPublicDate": "2007-10-23T00:00:00",
"FUNCTION": "Involved in centrosome duplication and mitotic progression",
"SUBCELLULAR LOCATION": "Cytoplasm",
"SIMILARITY": "Belongs to ... | {
"value": "MGRFKGENRSQARWIMGGVSKGRGSGKSRKPRQAAFGQTGARVCPSSPQQDAVPRFRWPGDAECASSTHTPTMSGCKLPMGLCPDMCPAAERARRERERRLHRLEVEPGGRGNAPRADPKRTVKEYSRPAAGKPRPPPSLLRPPPVLLATVRYLAGEVAGRGDVSCAEVASFVADRLRAVRLDLSLQGVDDADAATVLEAALATLLAVVARVRPEETRGAADPVLLQTQVQEGFGSLRRCYARGKGPYPRQAAFQGLFLLYNLGSVEALQEVLQLPAALRACPPLQAALAVDAAFREDNHARLFRL... |
A6NFA1 | This is Metalloprotease TIKI2 protein, from Human, contains 517 amino acids, is membrane-bound, locates in Cell membrane. | [] | {
"primaryAccession": "A6NFA1",
"organism_name": "Human",
"protein_name": "Metalloprotease TIKI2",
"length": 517,
"firstPublicDate": "2008-09-02T00:00:00",
"FUNCTION": "Metalloprotease that acts as a negative regulator of the Wnt signaling pathway by mediating the cleavage of the 8 N-terminal residues of a ... | {
"value": "MHAALAGPLLAALLATARARPQPPDGGQCRPPGSQRDLNSFLWTIRRDPPAYLFGTIHVPYTRVWDFIPDNSKAAFQASTRVYFELDLTDPYTISALASCQLLPHGENLQDVLPHELYWRLKRHLDYVKLMMPSWMTPAQRGKGLYADYLFNAIAGNWERKRPVWVMLMVNSLTERDVRFRGVPVLDLYLAQQAEKMKKTTGAVEQVEEQCHPLNNGLNFSQVLFALNQTLLQQESVRAGSLQASYTTEDLIKHYNCGDLSAVIFNHDTSQLPNFINTTLPPHEQVTAQEIDSYFRQELIYKRNER... |
A6NK89 | This is Ras association domain-containing protein 10 protein, from Human, contains 507 amino acids, is soluble, locates in Cytoplasm. | [] | {
"primaryAccession": "A6NK89",
"organism_name": "Human",
"protein_name": "Ras association domain-containing protein 10",
"length": 507,
"firstPublicDate": "2008-04-29T00:00:00",
"FUNCTION": "Plays an important role in regulating embryonic neurogenesis",
"SUBCELLULAR LOCATION": "Cytoplasm",
"SIMILARITY"... | {
"value": "MDPSEKKISVWICQEEKLVSGLSRRTTCSDVVRVLLEDGCRRRRRQRRSRRLGSAGDPHGPGELPEPPNEDDEDDDEALPQGMLCGPPQCYCIVEKWRGFERILPNKTRILRLWAAWGEEQENVRFVLVRSEASLPNAGPRSAEARVVLSRERPCPARGAPARPSLAMTQEKQRRVVRKAFRKLAKLNRRRQQQTPSSCSSTSSSTASSCSSSPRTHESASVERMETLVHLVLSQDHTIRQQVQRLHELDREIDHYEAKVHLDRMRRHGVNYVQDTYLVGAGIELDGSRPGEEPEEVAAEAEEAAA... |
A6P6V9 | This is Cannabidiolic acid synthase protein, from Hemp, contains 544 amino acids, is soluble, locates in Extracellular. | [] | {
"primaryAccession": "A6P6V9",
"organism_name": "Hemp",
"protein_name": "Cannabidiolic acid synthase",
"length": 544,
"firstPublicDate": "2013-02-06T00:00:00",
"FUNCTION": "Oxidoreductase involved in the biosynthesis of cannabinoids-related terpenophenolic natural products, which have pharmacological activ... | {
"value": "MKCSTFSFWFVCKIIFFFFSFNIQTSIANPRENFLKCFSQYIPNNATNLKLVYTQNNPLYMSVLNSTIHNLRFTSDTTPKPLVIVTPSHVSHIQGTILCSKKVGLQIRTRSGGHDSEGMSYISQVPFVIVDLRNMRSIKIDVHSQTAWVEAGATLGEVYYWVNEKNENLSLAAGYCPTVCAGGHFGGGGYGPLMRNYGLAADNIIDAHLVNVHGKVLDRKSMGEDLFWALRGGGAESFGIIVAWKIRLVAVPKSTMFSVKKIMEIHELVKLVNKWQNIAYKYDKDLLLMTHFITRNITDNQGKNKT... |
End of preview.
No dataset card yet
- Downloads last month
- 49